Cat: PAX2000-12265

Recombinant Human TUBA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TUBA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Alpha-tubulin 1; ALS22; B ALPHA 1; bA408E5.3; H2 ALPHA; Hum a tub1; Hum a tub2; LIS3; MGC171407; MGC55332; TBA4A_HUMAN; Testis-specific alpha-tubulin; TUBA1; TUBA1A; tuba1l; Tuba4a; Tubulin alpha 1 chain; Tubulin alpha; Tubulin alpha-1 chain; tubulin alpha-1B chain; Tubulin alpha-4A chain; Tubulin H2-alpha; Tubulin. alpha 1 (testis specific); tubulin. alpha 1. like; Tubulin. alpha 4a; Tubulin. alpha. testis-specific; Tubulin. alpha-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P68366

  • Expression Region

    1-448 aa

  • AA Sequence

    MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE

  • Molecular Weight

    49.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TUBA1 is a member of the α-tubulin family, which plays a critical role in the formation of microtubules, essential components of the cytoskeleton in eukaryotic cells. Microtubules are instrumental in various cellular processes, including cell division, intracellular transport, and maintenance of cell shape. Due to TUBA1's pivotal role in these processes, its dysfunction has been implicated in several diseases, including neurodegenerative disorders and various forms of cancer. Recent studies have focused on the recombinant expression of TUBA1 to elucidate its structural and functional properties. By generating recombinant TUBA1 protein, researchers aim to investigate its interactions with other tubulin isoforms and microtubule-associated proteins, which can provide insights into the mechanisms of microtubule dynamics and stability. Moreover, understanding TUBA1's role in pathological conditions could lead to the identification of novel therapeutic targets. As a result, the recombinant expression and characterization of TUBA1 is not only significant for fundamental biological research but also holds potential implications for developing treatments for diseases linked to microtubule dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US