Analytical Data
-
Gene name
FBXO27
- Application
-
Alternative Names
FBXO27; FBG5; FBX27F-box only protein 27; F-box/G-domain protein 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NI29
-
Expression Region
1-283aa
-
AA Sequence
MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXO27 is a member of the F-box protein family, which plays a critical role in the ubiquitin-proteasome system, a key pathway for protein degradation and cellular regulation. Studies have shown that FBXO27 is involved in targeting specific substrates for ubiquitination, thereby influencing various cellular processes such as cell cycle regulation, apoptosis, and signal transduction. Recent research has highlighted its potential implications in cancer biology, particularly due to its association with the regulation of key tumor suppressors and oncogenes. Given its significant role in modulating cellular pathways, FBXO27 has garnered interest as a potential therapeutic target and biomarker in cancer diagnostics. To further understand the functional mechanisms of FBXO27, researchers have begun to focus on the production and characterization of recombinant FBXO27 protein. This approach allows for detailed biochemical and biophysical studies, facilitating insights into its interaction with substrates and other components of the ubiquitin-proteasome system. The exploration of FBXO27's structure-function relationship also paves the way for identifying small molecules that could modulate its activity, offering new avenues for targeted therapies in diseases associated with its dysregulation.
