Analytical Data
-
Gene name
TTC10
- Application
-
Alternative Names
D13S1056E; DAF19; hTg737; Ift88; IFT88_HUMAN; Intraflagellar transport 88 homolog; Intraflagellar transport Protein 88 homolog; MGC26259; Polaris homolog; Probe hTg737 (polycystic kidney disease; autosomal recessive); Recessive polycystic kidney disease Protein Tg737 homolog; RP11-172H24.2; Tetratricopeptide repeat domain 10; Tetratricopeptide repeat Protein 10; TG737; TPR repeat Protein 10; TTC10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13099
-
Expression Region
724-833 aa
-
AA Sequence
RLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TTC10 is a member of the tetratricopeptide repeat (TPR) protein family, which is characterized by its multiple TPR motifs that facilitate protein-protein interactions. Research into TTC10 has gained momentum due to its potential roles in various cellular processes, including gene regulation, mitochondrial function, and apoptosis. The protein has been implicated in several diseases, including cancer, where dysregulation of its expression may contribute to tumorigenesis. Additionally, TTC10 has shown involvement in modulating the immune response, making it a candidate for therapeutic interventions targeting autoimmune disorders. Understanding the structure and function of TTC10 through recombinant protein studies is crucial for elucidating its mechanisms of action and developing potential biomarkers or treatment strategies. Researchers utilize techniques such as molecular cloning and expression systems to produce recombinant TTC10, enabling detailed characterization and functional assays that can reveal its biological roles and interactions with other cellular proteins. This research not only sheds light on the fundamental biology surrounding TTC10 but also paves the way for exploiting this protein in biotechnology and medicinal applications.
