Analytical Data
-
Gene name
FARP1
- Application
-
Alternative Names
CDEP; Chondrocyte derived ezrin like protein; Chondrocyte-derived ezrin-like protein; FARP1; FARP1_HUMAN; FERM RhoGEF and pleckstrin domain containing protein 1; FERM; FERM RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived); FERM; ARHGEF
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4F1
-
Expression Region
1-129aa
-
AA Sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FARP1 (F ERM-binding protein 1) is a critical protein involved in various cellular processes, including cell signaling, cytoskeletal dynamics, and cellular adhesion. Research on FARP1 has gained momentum due to its potential implications in disease mechanisms, particularly in cancer and neurological disorders. FARP1 interacts with the ezrin-radixin-moesin (ERM) family of proteins, which play essential roles in linking the plasma membrane to the cytoskeleton, thus influencing cell shape and motility. Additionally, FARP1 has been shown to modulate the activity of Rho GTPases, which are pivotal in regulating the actin cytoskeleton and important in the context of cell migration and invasion. Several studies indicate that altered expression and activity of FARP1 may contribute to tumorigenesis and metastasis in various cancers, making it a potential target for therapeutic interventions. Furthermore, the understanding of FARP1's role in neuronal cells provides insights into its potential involvement in neurodevelopmental processes and neurodegenerative diseases. Therefore, the production and characterization of recombinant FARP1 protein are crucial for elucidating its biological functions and exploring its involvement in disease pathways, which may pave the way for novel therapeutic strategies. This research not only enhances our comprehension of the fundamental roles of FARP1 in cellular physiology but also highlights its significance as a biomarker and therapeutic target in various pathological conditions.
