Analytical Data
-
Gene name
FANCL
- Application
-
Alternative Names
E3 ubiquitin-protein ligase FANCL; FAAP43; Fancl; FANCL_HUMAN; Fanconi anemia complementation group L; Fanconi anemia group L protein; Fanconi anemia-associated polypeptide of 43 kDa; FLJ10335; PHD finger protein 9; PHF9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NW38
-
Expression Region
1-375aa
-
AA Sequence
MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADRVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNVIFGECPYCSKPITLKMSGRKH
-
Molecular Weight
66.99 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FANCL, or Fanconi anemia associated nuclease homolog, plays a crucial role in the DNA damage response and repair mechanisms, particularly in the context of Fanconi anemia (FA), a genetic disorder characterized by increased sensitivity to DNA cross-linking agents and a higher risk of cancer. Research into FANCL has gained prominence due to its involvement in the FA pathway, which is essential for maintaining genomic stability and preventing malignancies. As one of the key components that facilitate the repair of damaged DNA, FANCL functions by orchestrating a series of biochemical reactions, including the ubiquitination of target proteins, which is vital for initiating the repair process. Studies have shown that mutations or dysregulation of FANCL can lead to severe developmental defects, bone marrow failure, and predisposition to various forms of cancer. Given its pivotal role in DNA repair, FANCL has become a target of intense research efforts aiming to develop therapeutic strategies that could enhance DNA repair mechanisms or counteract the effects of FA. Advances in recombinant protein technology have enabled researchers to produce and study FANCL and its interactions more systematically, providing insights into its molecular functions and potential as a biomarker or therapeutic target in diseases linked to DNA damage and instability. This understanding aids in the development of novel interventions for FA and related disorders, highlighting the importance of FANCL in cancer research and therapeutic development.
