Analytical Data
-
Gene name
ZNF525
- Application
-
Alternative Names
ZNF525; KIAA1979; Zinc finger Protein 525
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N782
-
Expression Region
1-70 aa
-
AA Sequence
MAFSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGSCCVVEIHLDLLSSRDPPQSPK
-
Molecular Weight
34.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF525 (Zinc Finger Protein 525) is a member of the zinc finger protein family, which is characterized by the presence of zinc finger motifs that enable the protein to bind to DNA and regulate gene expression. Research into ZNF525 has gained significance due to its potential roles in various biological processes, including cell differentiation, proliferation, and development. Studies have indicated that ZNF525 may be involved in the regulation of genes associated with cancer and other diseases, making it a target of interest for therapeutic interventions. The reconstitution of ZNF525 as a recombinant protein allows for detailed investigation of its structural and functional properties, enabling researchers to explore its mechanisms of action at a molecular level. Additionally, understanding the interactions of ZNF525 with other cellular components can provide insights into its regulatory pathways and its role in disease pathogenesis. Given the prevalence of zinc finger proteins in transcriptional regulation and their involvement in critical cellular functions, the study of ZNF525 presents opportunities for elucidating new approaches in gene therapy and molecular diagnostics. Overall, research on recombinant ZNF525 not only contributes to our understanding of zinc finger proteins but also holds promise for developing novel strategies in treating diseases linked to its dysregulation.
