Analytical Data
-
Gene name
FAM60A
- Application
-
Alternative Names
SINHCAF; C12orf14; FAM60A; L4; SIN3-HDAC complex-associated factor; Protein FAM60A; Tera protein homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP50
-
Expression Region
1-221aa
-
AA Sequence
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM60A, a member of the FAM family of proteins, has gained attention due to its potential roles in various cellular processes, including cell cycle regulation, apoptosis, and DNA repair. Recent studies have demonstrated that FAM60A is involved in the regulation of gene expression, particularly in response to stress signals, which suggests it may play a crucial role in maintaining cellular homeostasis. Alterations in FAM60A expression have been linked to several cancers, where it may influence tumor progression and metastasis, making it a prospective biomarker for cancer prognosis. Moreover, the protein's involvement in cellular pathways highlights its potential as a therapeutic target. To further understand the specific functions and mechanisms of FAM60A, researchers have focused on developing recombinant FAM60A proteins for detailed biochemical characterization and functional assays. This research aims to elucidate the molecular interactions of FAM60A within cellular contexts, thereby providing insights into its contributions to health and disease. Understanding the functional dynamics of FAM60A could pave the way for novel therapeutic strategies in cancer and other diseases associated with its dysregulation.











