Analytical Data
-
Gene name
ZNF468
- Application
-
Alternative Names
ZNF468Zinc finger Protein 468
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VIY5
-
Expression Region
1-469 aa
-
AA Sequence
MLKTLSSTGQGNTEVIHTGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQLGSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHMREKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP
-
Molecular Weight
80.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF468, a member of the zinc finger protein family, has garnered attention in molecular biology due to its potential roles in gene regulation and cellular processes. It is implicated in various biological functions, including cell differentiation, proliferation, and apoptosis. Research has suggested that ZNF468 may participate in the regulation of crucial developmental pathways, making it a subject of interest in the context of developmental biology and disease mechanisms, particularly in cancer. The study of recombinant ZNF468 proteins can provide valuable insights into its functional properties, interaction with DNA, and potential binding partners. By investigating the structure-function relationship of ZNF468, researchers aim to elucidate its regulatory mechanisms and contributions to gene expression. Understanding the biochemical and biophysical characteristics of ZNF468 is essential for exploring its therapeutic potential, as abnormalities in zinc finger proteins have been linked to various diseases. Overall, the recombinant expression of ZNF468 can pave the way for in-depth studies, facilitating the development of targeted therapies and advancing our knowledge of protein interactions in cellular systems.
