Analytical Data
-
Gene name
IRF9
- Application
-
Alternative Names
IRF9；ISGF3G；Interferon regulatory factor 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00978
-
Expression Region
1-393aa
-
AA Sequence
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IRF9 (Interferon Regulatory Factor 9) is a crucial transcription factor that plays a significant role in the immune response, particularly in the context of antiviral defense. It is part of the IRF family and is predominantly activated by type I interferons, which are crucial for orchestrating immune responses against viral infections. The research surrounding IRF9 has gained traction due to its involvement in various cellular processes, including cell growth, differentiation, and apoptosis, as well as its implications in autoimmune diseases and cancers. Enhanced understanding of IRF9 function may offer insights into therapeutic targets for conditions linked to immune dysregulation. In recent studies, the recombinant IRF9 protein has been produced to investigate its structural and functional properties, interactions with other signaling molecules, and regulatory mechanisms. This research is pivotal not only for elucidating the intricate network of immune signaling pathways but also for developing novel strategies in immunotherapy, particularly in enhancing antiviral responses or modulating aberrant immune activities in disease contexts. Overall, the ongoing exploration of IRF9 and its recombinant forms aims to provide a comprehensive understanding of its vital role in immunity and pave the way for innovative treatment options for infectious and inflammatory diseases.
