Analytical Data
-
Gene name
FAM58A
- Application
-
Alternative Names
Cyclin-M; Cyclin-related protein FAM58A; FA58A_HUMAN; Fam58a; Family with sequence similarity 58 member A; STAR
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1B3
-
Expression Region
1-214aa
-
AA Sequence
MEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTEIP
-
Molecular Weight
51.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM58A, also known as Family with Sequence Similarity 58 Member A, has garnered attention in the field of molecular biology due to its potential role in various cellular processes and disease mechanisms. This protein is thought to be involved in cell proliferation, apoptosis, and immune responses, making it a subject of interest in cancer research and immunology. Recent studies have indicated that FAM58A may play a crucial role in the response to viral infections and might be implicated in the regulation of the cell cycle. Researchers have focused on recombinant protein techniques to produce FAM58A for functional assays and structural studies. By generating recombinant FAM58A, scientists aim to elucidate its molecular function, interaction partners, and biological pathways. Understanding the structure and function of FAM58A could provide insights into its role in pathophysiological conditions, potentially leading to the identification of novel therapeutic targets. As such, the research on FAM58A recombinant proteins is pivotal for advancing our understanding of this enigmatic protein and its implications in health and disease.
