Analytical Data
-
Gene name
FAM54B
- Application
-
Alternative Names
MTFR1L; FAM54B; HYST1888; MSTP116Mitochondrial fission regulator 1-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H019
-
Expression Region
1-292aa
-
AA Sequence
MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
-
Molecular Weight
58.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM54B, or Family with Sequence Similarity 54 Member B, is a gene that encodes a protein believed to play roles in cellular processes such as proliferation, differentiation, and apoptosis. Recent studies have indicated that FAM54B may be implicated in various human diseases, including cancer, where its expression patterns can influence tumor growth and progression. Understanding the function of FAM54B and its resultant protein is crucial for elucidating its role in these biological processes. Recombinant FAM54B protein has gained attention for its potential use in functional assays and molecular biology research, providing insights into its mechanisms of action. The production of this protein through recombinant technology allows for higher yields and greater purity than traditional methods, enabling more accurate analyses. Researchers are focusing on studying the structure, interaction partners, and biological activity of the FAM54B protein to unravel its functions and potential therapeutic implications. By exploring the protein’s role in various cellular pathways, scientists hope to develop targeted interventions for diseases associated with FAM54B dysregulation. Overall, the study of recombinant FAM54B protein is essential for advancing our understanding of its biological significance and potential applications in biomedicine.











