Analytical Data
-
Gene name
SCGB3A2
- Application
-
Alternative Names
SCGB3A2；ApolipoProtein A-I
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PL1
-
Expression Region
22-93aa
-
AA Sequence
FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCV NELGPEASEAVKKLLEALSHLV
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCGB3A2, also known as Secretoglobin family 3A member 2, is a protein that belongs to the secretoglobin superfamily and has garnered significant interest in biomedical research due to its potential roles in various physiological and pathological processes. Initially identified in the respiratory tract, SCGB3A2 is predominantly expressed in lung epithelial cells and has been suggested to play a role in protecting mucosal surfaces and modulating immune responses. Its expression is altered in several pulmonary diseases, including asthma and chronic obstructive pulmonary disease (COPD), making it a candidate biomarker for these conditions. Moreover, investigations into SCGB3A2 have revealed its involvement in cellular signaling pathways, potentially influencing tumorigenesis and inflammation. The recombinant production of SCGB3A2 allows for in-depth studies into its structure-function relationships, interactions with other molecules, and biological effects, which can enhance our understanding of its role in lung health and disease. Overall, research on SCGB3A2 holds promise for revealing new therapeutic targets and improving diagnostic strategies in respiratory diseases and beyond.
