Cat: PA1000-8376

Recombinant Human SCGB3A2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCGB3A2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCGB3A2;ApolipoProtein A-I

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96PL1

  • Expression Region

    22-93aa

  • AA Sequence

    FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCV NELGPEASEAVKKLLEALSHLV

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCGB3A2, also known as Secretoglobin family 3A member 2, is a protein that belongs to the secretoglobin superfamily and has garnered significant interest in biomedical research due to its potential roles in various physiological and pathological processes. Initially identified in the respiratory tract, SCGB3A2 is predominantly expressed in lung epithelial cells and has been suggested to play a role in protecting mucosal surfaces and modulating immune responses. Its expression is altered in several pulmonary diseases, including asthma and chronic obstructive pulmonary disease (COPD), making it a candidate biomarker for these conditions. Moreover, investigations into SCGB3A2 have revealed its involvement in cellular signaling pathways, potentially influencing tumorigenesis and inflammation. The recombinant production of SCGB3A2 allows for in-depth studies into its structure-function relationships, interactions with other molecules, and biological effects, which can enhance our understanding of its role in lung health and disease. Overall, research on SCGB3A2 holds promise for revealing new therapeutic targets and improving diagnostic strategies in respiratory diseases and beyond.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US