Analytical Data
-
Gene name
FAM129B
- Application
-
Alternative Names
bA356B19.6; C9orf88; chromosome 9 open reading frame 88 ; DKFZP434H0820; FAM129B; family with sequence similarity 129; member B; FLJ13518; FLJ22151; FLJ22298; hypothetical protein LOC64855 ; Meg 3 ; Meg-3; Meg3; Niban like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96TA1
-
Expression Region
1-526aa
-
AA Sequence
MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSVSSPHLLQPFGP
-
Molecular Weight
87.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM129B, a member of the family of proteins associated with cellular responses to stress and apoptosis, has garnered significant interest in the field of molecular biology. This protein has been implicated in various physiological and pathological processes, including cancer progression and immune responses. Research indicates that FAM129B may play a crucial role in regulating cell survival and death pathways by influencing signaling cascades, particularly those related to apoptosis and autophagy. Its expression levels can vary in different tissues and under various stress conditions, highlighting its potential as a biomarker for disease states. Additionally, recent studies have suggested that FAM129B might interact with other key regulatory proteins, further emphasizing its importance in cellular function. Understanding the structure and function of recombinant FAM129B can provide valuable insights into its biological roles and mechanisms of action, paving the way for therapeutic applications in diseases where it is dysregulated. The exploration of FAM129B as a target for drug development may offer new strategies for treating conditions associated with its altered expression, particularly in cancer and inflammatory diseases. Overall, the research on FAM129B not only sheds light on its biological significance but also opens up avenues for potential therapeutic interventions.
