Cat: PA1000-8375

Recombinant Human SLURP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLURP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLURP1;ARS;Secreted Ly-6/uPAR-related Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55000

  • Expression Region

    23-103aa

  • AA Sequence

    LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

  • Molecular Weight

    10.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLURP1, a secreted protein predominantly expressed in the skin and nervous system, has garnered significant attention for its potential roles in various physiological and pathological processes. Initially identified as a neuromodulator in the peripheral nervous system, SLURP1 is believed to influence keratinocyte function and exhibit anti-inflammatory properties, making it a candidate for therapeutic exploration in skin-related conditions. Furthermore, its interactions with nicotinic acetylcholine receptors have raised interest in its implications for neurodegenerative diseases and pain modulation. Research has revealed that mutations in the SLURP1 gene are associated with certain genetic skin disorders, such as Mal de Meleda, further highlighting its importance in dermatology and genetics. The recombinant production of SLURP1 protein allows for extensive studies into its structure-function relationship, paving the way for elucidating its biological mechanisms. This could provide insights into its diverse roles and potential applications in drug development and treatment strategies for related diseases. Understanding SLURP1 at a molecular level could open new avenues in personalized medicine and targeted therapies, making it a compelling subject for ongoing research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US