Analytical Data
-
Gene name
SLURP1
- Application
-
Alternative Names
SLURP1；ARS；Secreted Ly-6/uPAR-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55000
-
Expression Region
23-103aa
-
AA Sequence
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
-
Molecular Weight
10.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLURP1, a secreted protein predominantly expressed in the skin and nervous system, has garnered significant attention for its potential roles in various physiological and pathological processes. Initially identified as a neuromodulator in the peripheral nervous system, SLURP1 is believed to influence keratinocyte function and exhibit anti-inflammatory properties, making it a candidate for therapeutic exploration in skin-related conditions. Furthermore, its interactions with nicotinic acetylcholine receptors have raised interest in its implications for neurodegenerative diseases and pain modulation. Research has revealed that mutations in the SLURP1 gene are associated with certain genetic skin disorders, such as Mal de Meleda, further highlighting its importance in dermatology and genetics. The recombinant production of SLURP1 protein allows for extensive studies into its structure-function relationship, paving the way for elucidating its biological mechanisms. This could provide insights into its diverse roles and potential applications in drug development and treatment strategies for related diseases. Understanding SLURP1 at a molecular level could open new avenues in personalized medicine and targeted therapies, making it a compelling subject for ongoing research.
