Analytical Data
-
Gene name
FAM126B
- Application
-
Alternative Names
FAM126BProtein FAM126B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IXS8
-
Expression Region
1-530aa
-
AA Sequence
MLGTDRCVVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELMWVYLRLTVSRDRQSNGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKHWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSSQRGSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSVELTPMKKHLSLPAGQVVPKINSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTVSLQEDRLGQAGEGKELLSPGAPLTKQSRSPSFNMQLISQV
-
Molecular Weight
85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM126B, a member of the FAM126 gene family, has emerged as a significant focus in molecular and cellular biology due to its potential roles in various physiological processes and diseases. Research indicates that FAM126B may be involved in cell proliferation, differentiation, and apoptosis, suggesting its importance in developmental biology and cancer research. Initial studies have associated FAM126B with myelination in the nervous system and have proposed its function in the regulation of membrane trafficking and cellular signaling pathways. Additionally, dysregulation of FAM126B has been linked to several diseases, including neurological disorders and certain types of cancer, underscoring its biomedical relevance. To further elucidate its function and mechanisms, researchers have been expressing and purifying recombinant FAM126B protein. This recombinant protein serves as a crucial tool for studying FAM126B's structure-function relationships, interaction with other cellular proteins, and its potential as a therapeutic target. Advancements in this area could lead to greater understanding of its role in health and disease, paving the way for novel therapeutic strategies. In summary, the study of recombinant FAM126B protein is pivotal in unraveling the complexities of its biological functions and contributions to pathophysiological conditions.











