Analytical Data
-
Gene name
CLDN4
- Application
-
Alternative Names
CLDN4;CPER;CPETR1;WBSCR8;Claudin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14493
-
Expression Region
1-209aa
-
AA Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGL WMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVV GGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNP LVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLDN4, or Claudin-4, is a member of the claudin protein family that plays a crucial role in the formation and maintenance of tight junctions in epithelial cells. These tight junctions are essential for maintaining the integrity of epithelial barriers, influencing permeability and aiding in the regulation of paracellular transport. Aberrant expression of CLDN4 has been implicated in various diseases, including cancer, where it is often upregulated in tumor tissues, potentially contributing to the metastatic process. Due to its association with malignancies, CLDN4 has emerged as a promising target for therapeutic interventions and biomarker development. Recombinant CLDN4 proteins are being studied for their potential applications in cancer diagnosis and treatment, as well as in the development of novel drug delivery systems. Additionally, understanding the precise mechanisms by which CLDN4 modulates cell signaling and interacts with other cellular components can provide insights into tumor biology and help identify new avenues for therapeutic strategies. Research involving the expression, purification, and characterization of recombinant CLDN4 proteins is vital for advancing our knowledge of its functional roles and therapeutic potential in oncology.











