Analytical Data
-
Gene name
FAM122C
- Application
-
Alternative Names
FAM122CProtein FAM122C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P4D5
-
Expression Region
1-152aa
-
AA Sequence
MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLNDNGLQKSSSLKCIDLTPVSSMASSIKKTGKSTSSYF
-
Molecular Weight
43.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM122C, a member of the FAM122 family of proteins, has garnered attention due to its potential roles in various biological processes, including cell proliferation, differentiation, and response to stress. Recent studies have indicated that FAM122C is involved in regulating the cell cycle and maintaining genomic stability, which are critical for normal cellular functions. The gene encoding FAM122C is thought to influence several signaling pathways that can impact tumorigenesis, making it a candidate for cancer research. Furthermore, its expression has been linked to various human diseases, underscoring the need to elucidate its function and mechanisms. The study of recombinant FAM122C proteins has become crucial for understanding their structure-function relationships and interactions at the molecular level. By producing and characterizing recombinant FAM122C, researchers aim to uncover its biological roles, potential as a biomarker, and therapeutic targets. This foundational knowledge could lead to advances in diagnostic and treatment strategies for related diseases, highlighting the significance of FAM122C in both basic and applied biomedical research.











