Analytical Data
-
Gene name
CLDN5
- Application
-
Alternative Names
CLDN5；AWAL；TMVCF；Claudin-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00501
-
Expression Region
1-218aa
-
AA Sequence
MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGL WMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLA GAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDP SVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKY SAPRRPTATGDYDKKNYV
-
Molecular Weight
50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLDN5, or Claudin-5, is a crucial tight junction protein that plays a significant role in the formation and maintenance of blood-brain barrier (BBB) integrity. It is primarily expressed in endothelial cells of the brain, where it contributes to the barrier's selective permeability, thus regulating the passage of ions, molecules, and cells between the bloodstream and the central nervous system. Research on CLDN5 recombinant proteins has gained momentum due to their potential applications in understanding neurovascular disorders, such as Alzheimer's disease, multiple sclerosis, and various types of brain tumors. By exploring the structural and functional properties of CLDN5, scientists aim to elucidate its mechanisms in maintaining BBB integrity and how its dysfunction might lead to pathological conditions. Moreover, CLDN5 has been investigated as a prospective target for drug delivery systems, where its unique properties could be exploited to design nanoparticles or therapeutic agents that can effectively cross the BBB. Thus, the study of CLDN5 recombinant proteins not only enhances our understanding of brain vascular biology but also opens new avenues for therapeutic strategies in treating neurological diseases.
