Cat: PA2000-7482

Recombinant Human FAM122B Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FAM122B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DKFZp686L20116; F122B_HUMAN; Fam122b; Family with sequence similarity 122B; MGC131814; OTTHUMP00000024067; OTTHUMP00000215087; Protein FAM122B

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z309

  • Expression Region

    1-248aa

  • AA Sequence

    MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVPSPRRFSSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK

  • Molecular Weight

    53.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FAM122B, a member of the FAM122 family, is implicated in various cellular processes, including cell proliferation, differentiation, and response to stress. Recent research has highlighted its potential role in oncogenesis, particularly its overexpression in several cancers, suggesting that FAM122B may serve as a tumor marker or therapeutic target. Furthermore, FAM122B has been linked to key signaling pathways, such as the mTOR pathway, which is crucial for cell growth and metabolism. The recombinant protein of FAM122B is essential for investigating its molecular functions and interactions, enabling researchers to elucidate its role in cellular processes and disease mechanisms. In studies, producing recombinant FAM122B allows for the examination of its effects on cellular behavior in vitro, as well as its potential interactions with other proteins involved in signaling pathways. Understanding the biological functions and mechanisms of FAM122B not only contributes to the fundamental knowledge of cellular biology but also has significant implications for developing novel therapeutic strategies for cancers and other diseases where FAM122B is dysregulated. As research progresses, the characterization of the FAM122B protein could lead to insights into its functions and open new avenues for targeted therapies, underlining the importance of continued investigation into this intriguing protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US