Cat: PA1000-8365

Recombinant Human CLDN6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CLDN6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLDN6;Claudin-6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56747

  • Expression Region

    1-220aa

  • AA Sequence

    MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGL WMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLA GAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNP LVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARY STSAPAISRGPSEYPTKNYV

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CLDN6 (claudin-6) is a member of the claudin family, which comprises essential components of tight junctions that play a crucial role in maintaining epithelial integrity and regulating paracellular permeability. Research on CLDN6 has gained traction due to its involvement in various physiological processes and pathophysiological conditions, such as cancer progression and metastasis, where its expression is often altered. Notably, CLDN6 has emerged as a promising target in cancer immunotherapy, particularly for solid tumors, as it is found to be overexpressed in several malignancies while being minimally expressed in normal tissues. This selective expression pattern makes it an attractive candidate for targeted therapies and the development of vaccines. The recombinant protein of CLDN6 can be produced to facilitate the study of its structure, function, and role in cell signaling pathways. Moreover, generating CLDN6-specific antibodies and exploring its potential as a biomarker for disease prognosis are key areas of ongoing research. The understanding of CLDN6's biological functions and its interactions within the tissue microenvironment could provide valuable insights into novel therapeutic strategies. As such, the study of CLDN6 recombinant protein not only contributes to elucidating the molecular mechanisms underlying its action but also holds significant promise for advancing targeted cancer therapies and improving clinical outcomes for patients.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US