Cat: PA1000-8364

Recombinant Human CLDN7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CLDN7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLDN7;CEPTRL2;CPETRL2;Claudin-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95471

  • Expression Region

    1-211aa

  • AA Sequence

    MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CLDN7 (Claudin-7) is a pivotal member of the claudin family of tight junction proteins, playing a crucial role in the regulation of paracellular permeability and maintaining epithelial barrier integrity. Recent studies have indicated that aberrant expression of CLDN7 is associated with various pathological conditions, including cancer progression, where it may contribute to enhanced invasiveness and metastasis. Researchers are increasingly interested in the functional characterization of CLDN7 as a therapeutic target, and its potential implications in diseases characterized by disrupted epithelial barriers. Additionally, given the importance of tight junctions in embryonic development and tissue homeostasis, understanding CLDN7's role may provide insights into developmental biology and tissue engineering. Recombination techniques have enabled the production of CLDN7 recombinant proteins for further investigation, allowing for detailed studies on its structural properties, interaction with other cellular components, and the nuances of its involvement in cell signaling pathways. Overall, the study of CLDN7 not only enhances our understanding of tight junction mechanics but also opens new avenues for developing interventions for diseases linked to tight junction dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US