Analytical Data
-
Gene name
FAM122A
- Application
-
Alternative Names
FAM122A; C9orf42Protein FAM122A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96E09
-
Expression Region
1-287aa
-
AA Sequence
MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM122A (Family with Sequence Similarity 122A) is a protein that has garnered attention in the fields of molecular biology and cancer research due to its potential roles in cellular signaling and oncogenesis. Initial studies have indicated that FAM122A is involved in the regulation of various cellular processes, including cell proliferation, apoptosis, and differentiation. Its expression levels have been linked to different types of cancers, suggesting that FAM122A may function as an oncogene or tumor suppressor, depending on the cellular context. Research into the recombinant production of FAM122A has been driven by the necessity to understand its functional mechanisms and interactions at the molecular level. By producing recombinant FAM122A, scientists can investigate its structural properties, binding affinities, and effects on signaling pathways. Additionally, the ability to purify and manipulate this protein in vitro allows for assays that can elucidate its role in disease progression and potential as a therapeutic target. Ultimately, the study of recombinant FAM122A contributes to the broader understanding of its biological significance and the development of novel strategies for cancer treatment.
