Analytical Data
-
Gene name
EVI2A
- Application
-
Alternative Names
EVI2A; EVDA; EVI2; Protein EVI2A; EVI-2A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22794
-
Expression Region
25-236aa
-
AA Sequence
SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
-
Molecular Weight
49.06 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EVI2A, or Ectopic Viral Integration site 2A, is a gene that has garnered increasing interest in molecular and cellular biology due to its implications in various physiological and pathological processes. Initially identified for its potential role in viral integration, recent studies have revealed that EVI2A is involved in important cellular mechanisms such as cell adhesion, migration, and signaling pathways, which are critical for developmental biology and cancer progression. Researchers are particularly interested in the expression and regulation of EVI2A, as alterations in its activity may contribute to the development of tumors and other diseases. Recombinant EVI2A proteins are being explored for their potential therapeutic applications, including their use in targeted therapies and as biomarkers for cancer diagnosis. The study of EVI2A also includes investigations into its interaction with other proteins and cellular components, enhancing our understanding of its biological functions. Overall, EVI2A represents a promising area of research that bridges virology, cellular biology, and cancer research, prompting further exploration into its role in health and disease.
