Cat: PA1000-8307

Recombinant Human DPYD Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DPYD

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DPYD;Dihydropyrimidine dehydrogenase [NADP(+)]

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12882

  • Expression Region

    1-173aa

  • AA Sequence

    MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCF NCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSF ITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Dihydropyrimidine dehydrogenase (DPYD) is a pivotal enzyme in the pyrimidine catabolic pathway, primarily responsible for the degradation of the nucleobases uracil and thymine. Deficiencies in DPYD can lead to severe adverse drug reactions, particularly in patients receiving fluoropyrimidine-based chemotherapies, such as 5-fluorouracil (5-FU), used in treating various cancers. Genetic polymorphisms in the DPYD gene significantly influence enzyme activity, leading to variability in drug metabolism and patient response. Consequently, the study of DPYD recombinant proteins has garnered significant attention, as it allows researchers to investigate the enzyme's structure-function relationships, characterize its kinetic properties, and explore potential inhibitors or activators that could modulate its activity. Understanding these aspects is crucial for developing personalized medicine approaches, optimizing chemotherapy regimens, and minimizing toxicities associated with pyrimidine analogs. Furthermore, DPYD research contributes to the broader field of pharmacogenomics, elucidating how genetic variations affect individual responses to drugs, thereby enhancing therapeutic efficacy and safety.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US