Cat: PAX2000-12056

Recombinant Human TMEM89 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM89

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM89; Transmembrane Protein 89

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A2RUT3

  • Expression Region

    1-159 aa

  • AA Sequence

    MLHVLASLPLLLLLVTSASTHAWSRPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHPQVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM89, a member of the transmembrane protein family, has garnered attention in recent years due to its potential role in various cellular processes, including cell signaling, membrane trafficking, and immune response. Initial studies have suggested that TMEM89 may be involved in the regulation of key signaling pathways, particularly those related to stress responses and cell survival. Its expression levels have been associated with various diseases, including cancer, where aberrant regulation of transmembrane proteins often correlates with tumor progression and poor prognosis. Researchers are increasingly recognizing the importance of elucidating the functional mechanisms of TMEM89, as well as its interactions with other cellular components. Recombination and expression of TMEM89 as a fusion protein in suitable expression systems have enabled researchers to study its structure-function relationship and to explore its biochemical properties. This research not only provides insights into the physiological roles of TMEM89 but also opens avenues for therapeutic interventions targeting its pathways. Further investigation into TMEM89 could reveal new biomarkers for disease and potential targets for drug development, particularly in oncology and immunology, where modulation of protein interactions and signaling pathways can significantly influence disease outcomes. As the understanding of TMEM89 continues to evolve, it holds promise for enhancing our comprehension of complex biological systems and contributing to the advancement of personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US