Analytical Data
-
Gene name
TMEM88
- Application
-
Alternative Names
TMEM88; TMEM88A; Transmembrane Protein 88
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PEY1
-
Expression Region
1-159 aa
-
AA Sequence
MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV
-
Molecular Weight
43.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM88 (Transmembrane Protein 88) is a member of the transmembrane protein family that has garnered interest due to its potential roles in various biological processes, particularly in cell signaling and development. Studies suggest that TMEM88 may function as a modulator of the Wnt signaling pathway, which is crucial for embryonic development and stem cell differentiation. Dysregulation of Wnt signaling has been implicated in several diseases, including cancer, making TMEM88 a target of investigation in cancer biology. Furthermore, the protein is believed to influence neuronal development and is associated with neurodegenerative disorders. Despite its significance, the precise molecular mechanisms of TMEM88 and its interactions with other signaling molecules remain poorly understood. The generation of recombinant TMEM88 protein is essential for elucidating its structure-function relationships and for conducting in vitro studies to explore its role in various signaling pathways. By employing techniques such as recombinant DNA technology and protein purification, researchers aim to produce functional TMEM88 protein for biochemical assays and structural analysis. Understanding TMEM88's role could provide insights into its potential as a therapeutic target and enhance our comprehension of the underlying mechanisms of diseases associated with Wnt signaling dysregulation. This research line not only emphasizes the importance of TMEM88 in basic biological processes but also opens avenues for potential therapeutic interventions in diseases where this protein is implicated.
