Analytical Data
-
Gene name
ETV4
- Application
-
Alternative Names
Adenovirus E1A enhancer binding protein; Adenovirus E1A enhancer-binding protein; E1A F; E1A-F; ETS translocation variant 4; ets variant gene 4 (E1A enhancer binding protein E1AF); ETV4; ETV4_HUMAN; PEA3; PEA3 protein; PEAS3; Polyomavirus enhancer activator 3; Polyomavirus enhancer activator 3 homolog; Protein PEA3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43268
-
Expression Region
1-207aa
-
AA Sequence
MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
-
Molecular Weight
48.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETV4, a member of the E26 transformation-specific (ETS) family of transcription factors, has emerged as a significant player in cancer biology and other cellular processes. Its role in regulating gene expression is pivotal in both normal development and pathological conditions. Increased ETV4 expression has been linked to tumor progression, metastasis, and poor prognosis in various cancers, including breast, prostate, and gastric cancers. Research has identified that ETV4 functions by activating oncogenic signaling pathways and modulating the transcription of genes involved in cell proliferation and survival. Additionally, ETV4 interacts with other regulatory proteins and epigenetic modifiers, enhancing its impact on the transcriptional landscape of cancer cells. The recombinant form of ETV4 enables researchers to dissect its functional domains, understand its interactions at a molecular level, and unravel its contribution to disease mechanisms. This protein's study is crucial for the development of targeted therapies that aim to inhibit ETV4 function or disrupt its pathways, offering a potential avenue for innovative cancer treatment strategies. As understanding the nuances of ETV4's involvement in oncogenesis continues to evolve, it holds promise not only for therapeutic interventions but also for advancing the knowledge of transcriptional regulation in cellular biology.
