Analytical Data
-
Gene name
ETNK1
- Application
-
Alternative Names
1110061E11Rik; 4930555L11Rik; AI195356; AI841245; C80956; D6Ertd3e; EKI 1; EKI; EKI1; EKI1_HUMAN; Ethanolamine kinase 1; ETNK1; Nbla10396; Putative protein product of Nbla10396
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBU6
-
Expression Region
1-169aa
-
AA Sequence
MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF
-
Molecular Weight
44.22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETNK1 (ethanolamine kinase 1) is an important enzyme involved in the biosynthesis of phospholipids and the metabolism of sphingolipids. This enzyme catalyzes the phosphorylation of ethanolamine to form phosphoethanolamine, a critical precursor for the synthesis of phosphatidylethanolamine, a major component of cell membranes. The role of ETNK1 extends beyond lipid metabolism, as it is implicated in various cellular processes, including signaling pathways and cellular stress responses. Recent studies have indicated that ETNK1 may play a significant role in cancer biology, where its expression levels can influence tumor growth and metastasis. Additionally, ETNK1 has been associated with neurological disorders, highlighting its potential as a therapeutic target. Research into the recombinant expression and purification of ETNK1 protein is crucial for elucidating its structure-function relationship, understanding its enzymatic mechanisms, and exploring its interactions with other biological molecules. The availability of purified ETNK1 will enable in vitro assays and structural studies, paving the way for drug discovery efforts aimed at modulating its activity in pathological conditions. Overall, the recombinant production of ETNK1 protein serves as a valuable tool in biomedical research, contributing to the understanding of its role in health and disease.
