Analytical Data
-
Gene name
TMEM50B
- Application
-
Alternative Names
TMEM50B; C21orf4; UNQ167/PRO193; Transmembrane Protein 50B; HCV p7-trans-regulated Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56557
-
Expression Region
1-158 aa
-
AA Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
-
Molecular Weight
44.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM50B (Transmembrane Protein 50B) is a relatively understudied protein that belongs to the family of membrane proteins involved in various cellular processes. Recent research has highlighted its potential roles in endosomal trafficking, cellular stress responses, and signal transduction pathways. The protein's unique structure and membrane localization suggest that it may play a crucial role in the maintenance of cellular homeostasis and the regulation of intracellular signaling networks. Given its involvement in essential biological processes, understanding TMEM50B's functional mechanisms has significant implications for various fields, including cancer research, neurobiology, and metabolic disorders. Recombinant TMEM50B protein production enables researchers to investigate its biochemical properties, interactions with other proteins, and cellular localization, fostering a deeper understanding of its role in health and disease. Additionally, the availability of this protein could pave the way for exploring its potential as a therapeutic target or biomarker in various pathologies. As the scientific community continues to unravel the complexities of membrane proteins, TMEM50B stands out as a promising candidate for further exploration, ultimately contributing to the broader understanding of cellular dynamics and disease mechanisms.
