Analytical Data
-
Gene name
DNM1
- Application
-
Alternative Names
DNM1；DLP1；DRP1；Dynamin-1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05193
-
Expression Region
2-245aa
-
AA Sequence
GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK
-
Molecular Weight
28.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dynamin 1 (DNM1) is a crucial GTPase involved in the process of endocytosis, specifically in the membrane fission events necessary for the recycling of synaptic vesicles in neurons. Its function is fundamental to various cellular processes, including neurotransmitter release, synaptic plasticity, and overall neuronal communication. Mutations or dysfunctions in DNM1 are associated with several neurodegenerative diseases and disorders, such as epilepsy and other synaptic pathologies, highlighting its importance in maintaining neural health. Research on recombinant DNM1 protein aims to elucidate its structural and functional mechanisms, which are essential for understanding how it mediates membrane dynamics at the molecular level. By producing recombinant DNM1, scientists can investigate the protein’s biochemical properties, interaction with other endocytic components, and its role in cellular signaling pathways. This research not only enhances our understanding of synaptic functions but also holds potential for developing therapeutic strategies targeting DNM1-related diseases. Thus, DNM1 recombinant protein studies continue to be a focal point in neurobiology, signaling research, and potential drug development, hoping to uncover novel approaches for treating neurological disorders linked to synaptic dysfunction.
