Cat: PA2000-7416

Recombinant Human ESRRG Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ESRRG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DKFZp781L1617; ERR 3; ERR G2; ERR gamma 2 ; ERR gamma-2; ERR3; ERR3_HUMAN; ERRG 2; ERRG2 ; ERRgamma; ESRRG; Estrogen receptor related protein 3; Estrogen receptor-related protein 3; Estrogen-related receptor gamma; FLJ16023; KIAA0832; NR3B3; Nuclear receptor subfamily 3 group B member 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62508

  • Expression Region

    1-442aa

  • AA Sequence

    MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTAPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLLLEMLEAKV

  • Molecular Weight

    74.36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ESRRG (estrogen-related receptor gamma) is an orphan nuclear receptor that plays a crucial role in various biological processes, including metabolism, energy homeostasis, and cellular differentiation. Its importance has been underscored by studies linking ESRRG to several metabolic disorders, obesity, and cancer. Given the receptor's role in regulating genes associated with mitochondrial function and oxidative metabolism, researchers have focused on understanding its mechanisms of action, ligand-binding properties, and potential as a therapeutic target. The production of recombinant ESRRG proteins allows scientists to investigate these aspects in vitro, facilitating the exploration of its structure-function relationships. Additionally, recombinant ESRRG serves as a tool for high-throughput screening of small molecules that can modulate its activity, which could lead to the development of novel strategies for treating metabolic diseases and cancer. The study of ESRRG reaffirms the need for ongoing research in the field of nuclear receptors, as insights gained from these investigations may contribute to a more comprehensive understanding of metabolic regulation and therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US