Analytical Data
-
Gene name
TMEM49
- Application
-
Alternative Names
Vacuole membrane Protein 1. Transmembrane Protein 49
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GC9
-
Expression Region
1-406 aa
-
AA Sequence
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
-
Molecular Weight
72.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM49, or Transmembrane Protein 49, is a member of the transmembrane protein family known to play critical roles in cellular processes such as signaling and membrane trafficking. Recent studies have highlighted TMEM49's potential involvement in various biological functions and its implications in pathologies, particularly in cancer and neurodegenerative diseases. Research has focused on the structure and function of TMEM49, unveiling its importance in cellular homeostasis and interaction with other proteins. The recombinant expression of TMEM49 provides a valuable tool for studying its functional properties, facilitating the understanding of its molecular mechanisms. Furthermore, generating TMEM49 as a recombinant protein allows researchers to explore its role in disease contexts, offering avenues for therapeutic intervention. Overall, the investigation of TMEM49 recombinant protein holds significant promise for advancing our understanding of its biological roles and potential implications in health and disease.
