Analytical Data
-
Gene name
ZNF18
- Application
-
Alternative Names
HDSG1; Heart development specific gene 1 Protein; Heart development specific Protein; Heart development-specific gene 1 Protein; KOX11; Zfp 535; Zfp535; Zinc finger Protein 18 (KOX 11); Zinc finger Protein 18; Zinc finger Protein 535; Zinc finger Protein KOX11; Zinc finger Protein with KRAB and SCAN domains 6; ZKSCAN6; ZNF 535; Znf18; ZNF18_HUMAN; ZNF535
-
Species
Human
-
Source
E. coli
-
Tag
His-DHFR tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17022
-
Expression Region
316-586 aa
-
AA Sequence
QRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECGKAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPY
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF18, a member of the Zinc Finger Protein family, has garnered increasing attention in recent years due to its potential roles in cellular processes and diseases. This protein is characterized by the presence of multiple zinc finger motifs, which are known to facilitate protein-DNA interactions, suggesting a role in gene regulation. Research has implicated ZNF18 in various biological processes, including cell differentiation, proliferation, and apoptosis. Furthermore, studies have indicated that dysregulation of ZNF18 may be associated with specific cancers and other pathological conditions. Given the significance of zinc finger proteins in transcriptional regulation, the recombinant expression of ZNF18 presents an opportunity to investigate its structure-function relationships and biological roles more thoroughly. By generating recombinant ZNF18 proteins, researchers can employ biochemical and biophysical techniques to assess its interaction with DNA and other protein partners, shedding light on its function in signaling pathways and gene expression. Additionally, exploring the therapeutic potential of targeting ZNF18 pathways could offer new avenues for cancer treatment and other related diseases. Overall, the study of recombinant ZNF18 protein stands to enhance our understanding of its biological significance and contribute to the broader field of molecular biology and therapeutic development.
