Analytical Data
-
Gene name
TMEM33
- Application
-
Alternative Names
TMEM33; DB83; Transmembrane Protein 33; Protein DB83; SHINC-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57088
-
Expression Region
1-247 aa
-
AA Sequence
MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP
-
Molecular Weight
54.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM33, a member of the transmembrane protein family, has garnered increasing attention due to its potential roles in various cellular processes, including membrane dynamics, intracellular signaling, and protein transport. Initially identified in studies related to cancer biology, TMEM33 has been implicated in tumor progression and metastasis, prompting investigations into its molecular mechanisms and functional significance. The gene encoding TMEM33 is located on chromosome 17, and its expression patterns have been linked to various physiological and pathological conditions. Recent research suggests that TMEM33 may influence cellular responses to stress, participate in endosomal trafficking, and impact autophagy, highlighting its relevance in maintaining cellular homeostasis. Furthermore, aberrations in TMEM33 expression have been associated with several diseases, including neurodegenerative disorders and cardiovascular diseases, suggesting its potential as a therapeutic target. Despite these findings, the precise functional mechanisms of TMEM33 remain largely unclear, necessitating further exploration through recombinant protein studies. Generating TMEM33 recombinant proteins can facilitate detailed investigations into its biochemical properties, interactions with other cellular components, and potential roles in disease. Understanding the structure-function relationships of TMEM33 through these recombinant approaches could unravel its contributions to cellular physiology and pathology, paving the way for novel therapeutic strategies targeting this enigmatic protein.
