Analytical Data
-
Gene name
TMEM30A
- Application
-
Alternative Names
TMEM30A; C6orf67; CDC50A; Cell cycle control Protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane Protein 30A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NV96
-
Expression Region
1-361 aa
-
AA Sequence
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI
-
Molecular Weight
67.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM30A, a member of the transmembrane protein family, has garnered significant attention in recent years due to its crucial role in regulating various cellular processes. Initially identified for its involvement in the maintenance of membrane potential and cellular homeostasis, TMEM30A has been linked to the modulation of lipid metabolism and endosomal trafficking. Research has indicated that this protein is essential for the proper functioning of P-type ATPases, which are vital for maintaining ion balance within cells. Furthermore, the dysregulation of TMEM30A has been implicated in several pathological conditions, including cancer, where it may contribute to tumor progression and metastasis by affecting cellular signaling pathways and membrane dynamics. The study of recombinant TMEM30A protein has become increasingly important as it provides insights into its structure-function relationship and potential therapeutic applications. Additionally, the production of this protein in a recombinant form allows for better characterization of its biochemical properties, interaction networks, and its role in various cellular contexts. As scientists continue to explore TMEM30A, its potential as a biomarker or therapeutic target in diseases offers promising new avenues for research and treatment strategies, underscoring the importance of understanding this protein's function in the intricate web of cellular processes.
