Analytical Data
-
Gene name
TMEM167B
- Application
-
Alternative Names
TMEM167B; C1orf119; AD-020; Protein kish-B; Transmembrane Protein 167B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRX6
-
Expression Region
1-74 aa
-
AA Sequence
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK
-
Molecular Weight
34.54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM167B, a member of the transmembrane protein family, has emerged as a subject of interest in the field of molecular biology and cell physiology due to its potential roles in cellular mechanisms and disease pathogenesis. Located in the endoplasmic reticulum, TMEM167B has been implicated in cellular processes such as protein folding, trafficking, and membrane dynamics. Recent studies have suggested that it may play a significant role in the modulation of autophagy and endosomal trafficking, which are crucial for maintaining cellular homeostasis. Mutations and dysregulation of TMEM167B have been linked to various diseases, including developmental disorders and neurodegenerative conditions, highlighting its potential as a therapeutic target. The production of recombinant TMEM167B protein provides a valuable tool for in-depth functional studies, allowing researchers to investigate its interactions, structural characteristics, and biological implications. By studying the recombinant version of this protein, scientists aim to elucidate its specific roles in cellular pathways and to explore its potential contributions to human health and disease, paving the way for novel therapeutic strategies.











