Analytical Data
-
Gene name
TMEM14A
- Application
-
Alternative Names
TMEM14A; C6orf73; PTD011; Transmembrane Protein 14A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6G1
-
Expression Region
1-99 aa
-
AA Sequence
MDLIGFGYAALVTFGSIFGYKRRGGVPSLIAGLFVGCLAGYGAYRVSNDKRDVKVSLFTAFFLATIMGVRFKRSKKIMPAGLVAGLSLMMILRLVLLLL
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM14A, a member of the transmembrane protein family, has garnered increasing attention in biomedical research due to its potential roles in various cellular processes, including mitochondrial function, lipid metabolism, and cellular signaling. Studies have indicated that TMEM14A may be involved in the regulation of mitochondrial dynamics and apoptosis, making it a significant candidate for research in metabolic disorders and cancer. Furthermore, the structural characteristics of TMEM14A, particularly its transmembrane domains, suggest that it could play a critical role in membrane transport mechanisms. The production of recombinant TMEM14A protein is crucial for detailed biochemical and biophysical studies, enabling researchers to investigate its functional properties, interactions with other proteins, and potential as a therapeutic target. Understanding the precise role of TMEM14A in cellular physiology could pave the way for novel therapeutic strategies for diseases associated with mitochondrial dysfunction and metabolic imbalance. Therefore, the generation and characterization of TMEM14A recombinant protein are vital steps in elucidating its biological functions and relevance in health and disease.
