Analytical Data
-
Gene name
PAR4
- Application
-
Alternative Names
PAR4；PAR4；Proteinase-activated receptor 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96IZ0
-
Expression Region
231-340aa
-
AA Sequence
SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT LLKVVGQLTR
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAR4 (Prostate Apoptosis Response-4) is a member of the apoptosis signal-regulating kinase (ASK) family, which plays a crucial role in regulating cell death and survival pathways. Its expression has been linked to various cancers, making it a significant target for cancer research. The focus on PAR4 reconstituted proteins stems from their potential to elucidate the mechanisms of tumorigenesis and to develop novel therapeutic strategies. Researchers have aimed to dissect the functional domains of PAR4 and to understand its interactions with other proteins involved in apoptosis and cell signaling. Additionally, studies have shown that PAR4 can induce apoptosis in cancer cells, suggesting that modulating its activity could provide a promising approach for cancer treatment. Given its dual role in promoting apoptosis and possibly regulating tumor progression, PAR4 is a compelling focus for synthetic biology and therapeutic development. As science progresses, the creation of PAR4 recombinant proteins facilitates in-depth investigation into its structure-function relationships and biological implications, paving the way for innovative interventions in cancer therapy.
