Cat: PAX2000-11993

Recombinant Human TMCO1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMCO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMCO1; TMCC4; PNAS-10; PNAS-136; UNQ151/PRO177; Calcium load-activated calcium channel; CLAC channel; Transmembrane and coiled-coil domain-containing Protein 1; Transmembrane and coiled-coil domains Protein 4; Xenogeneic cross-immune Protein PCIA3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UM00

  • Expression Region

    1-188 aa

  • AA Sequence

    MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

  • Molecular Weight

    47.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMCO1, or Transmembrane and Coiled-Coil Domain 1, has emerged as a significant protein in cellular biology due to its crucial roles in various physiological processes. Initially identified through genomic studies, TMCO1 is located in the endoplasmic reticulum and is believed to be involved in calcium homeostasis, protein quality control, and cellular stress responses. Recent findings suggest its potential implications in the pathophysiology of certain diseases, including neurodegenerative disorders and metabolic syndromes, as altered TMCO1 expression has been linked to dysregulated cellular environments. Researchers have been focused on the characterization of TMCO1 as a recombinant protein to better understand its functional dynamics and interaction with other cellular components. The generation of TMCO1 recombinant protein allows for in-depth studies of its structural properties, facilitates the investigation of protein-protein interactions, and aids in the exploration of its mechanistic roles within signaling pathways. Furthermore, understanding TMCO1's function at a molecular level could open avenues for therapeutic interventions targeted at conditions associated with its dysregulation. Overall, TMCO1 stands as an intriguing candidate for further research, emphasizing the need for comprehensive studies to unravel its contributions to cellular physiology and disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US