Analytical Data
-
Gene name
TM2D2
- Application
-
Alternative Names
TM2D2; BLP1; TM2 domain-containing Protein 2; Beta-amyloid-binding Protein-like Protein 1; BBP-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BX73
-
Expression Region
1-214 aa
-
AA Sequence
MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSQNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
-
Molecular Weight
49.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TM2D2 (Transmembrane Domain 2 Domain-containing 2) is a relatively recently identified protein that has garnered attention in the field of molecular biology due to its potential roles in cellular signaling and membrane dynamics. Previous studies have suggested that TM2D2 may be involved in critical physiological processes, including cell proliferation and differentiation. However, the specific functions and mechanisms of TM2D2 remain largely uncharacterized. Researchers have begun to explore the structural and functional characteristics of this protein, with particular interest in its transmembrane domains that may influence protein interactions and cellular localization. Additionally, the study of TM2D2 is relevant to understanding various diseases, including cancer and neurodegenerative disorders, where cellular signaling pathways are often disrupted. The development of recombinant TM2D2 proteins allows for advanced studies on its biological activities and interactions with other cellular components, providing insights that could lead to novel therapeutic strategies. As the scientific community continues to investigate TM2D2, its burgeoning importance in understanding cellular mechanics and disease pathology may pave the way for significant breakthroughs in biomedicine.
