Analytical Data
-
Gene name
LRP5L
- Application
-
Alternative Names
LRP5L；Low-density lipoProtein receptor-related Protein 5-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A4QPB2
-
Expression Region
1-252aa
-
AA Sequence
MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKILVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLKAVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRP5L, or LDL Receptor-related Protein 5-Like, is a protein that plays a crucial role in various biological processes, including lipid metabolism, bone formation, and cell signaling. Research has shown that LRP5L is involved in the modulation of Wnt signaling pathways, which are essential for embryonic development and the regulation of stem cell differentiation. The significance of LRP5L is underscored by its association with various diseases, including osteoporosis and certain cancer types, where dysregulation of Wnt signaling is implicated. The recombinant production of LRP5L has gained attention in recent years as a methodology to better understand its structure-function relationships and biological activities. By generating recombinant LRP5L, researchers can investigate its interactions with other proteins, assess its role in cellular pathways, and explore its potential as a therapeutic target. Moreover, studying the recombinant protein can facilitate the development of assays, enabling high-throughput screening for compounds that might modulate its function. Overall, the exploration of LRP5L through recombinant protein studies holds promise for advancing our understanding of its biological roles and potential involvement in pathophysiological conditions.
