Cat: PA1000-8222

Recombinant Human APBA3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APBA3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APBA3;MINT3;X11L2;Amyloid-beta A4 precursor Protein-binding family A member 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O96018

  • Expression Region

    1-138aa

  • AA Sequence

    MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRM ELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAH GLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APBA3, also known as amyloid beta-binding protein 3, has garnered significant interest in recent research due to its potential role in neurodegenerative diseases, particularly Alzheimer's disease. This protein is involved in the regulation of synaptic functions and the processing of amyloid precursor protein (APP), influencing amyloid-beta peptide production. The accumulation of amyloid-beta is a hallmark of Alzheimer's pathology, leading to neuronal damage and cognitive decline. Studies suggest that APBA3 may modulate the amyloidogenic pathway, offering a possible target for therapeutic intervention. Additionally, the protein's involvement in synaptic signaling and its interactions with various molecular partners indicate that it could play a multifaceted role in the central nervous system. Research into the recombinant expression of APBA3 aims to elucidate its functional mechanisms and potential pathways for modulation, thereby contributing to the development of novel strategies for the treatment or prevention of Alzheimer’s disease and other related disorders. Understanding the structural and functional dynamics of APBA3 could unlock new avenues for drug design and provide deeper insights into the intricate processes underlying neurodegeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US