Analytical Data
-
Gene name
APBA3
- Application
-
Alternative Names
APBA3；MINT3；X11L2；Amyloid-beta A4 precursor Protein-binding family A member 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O96018
-
Expression Region
1-138aa
-
AA Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRM ELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAH GLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APBA3, also known as amyloid beta-binding protein 3, has garnered significant interest in recent research due to its potential role in neurodegenerative diseases, particularly Alzheimer's disease. This protein is involved in the regulation of synaptic functions and the processing of amyloid precursor protein (APP), influencing amyloid-beta peptide production. The accumulation of amyloid-beta is a hallmark of Alzheimer's pathology, leading to neuronal damage and cognitive decline. Studies suggest that APBA3 may modulate the amyloidogenic pathway, offering a possible target for therapeutic intervention. Additionally, the protein's involvement in synaptic signaling and its interactions with various molecular partners indicate that it could play a multifaceted role in the central nervous system. Research into the recombinant expression of APBA3 aims to elucidate its functional mechanisms and potential pathways for modulation, thereby contributing to the development of novel strategies for the treatment or prevention of Alzheimer’s disease and other related disorders. Understanding the structural and functional dynamics of APBA3 could unlock new avenues for drug design and provide deeper insights into the intricate processes underlying neurodegeneration.
