Analytical Data
-
Gene name
ELOVL4
- Application
-
Alternative Names
ELOVL4; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase ELOVL4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZR5
-
Expression Region
1-314aa
-
AA Sequence
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVH EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMI ENGKKQKNGKAKGD
-
Molecular Weight
36.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELOVL4 (elongation of very long chain fatty acids protein 4) is a pivotal enzyme involved in the elongation of long-chain fatty acids, which are essential for the synthesis of various lipids, including those critical for retinal and neuronal functions. Mutations in the ELOVL4 gene have been linked to a range of retinal dystrophies, including Stargardt-like macular degeneration, highlighting its significance in maintaining photoreceptor health and visual acuity. Research on the recombinant ELOVL4 protein aims to elucidate its biochemical properties and functional roles in fatty acid elongation pathways. By producing ELOVL4 in a recombinant system, scientists can investigate its enzymatic activity, substrate specificity, and interactions with other cellular molecules. This research not only enhances our understanding of the molecular mechanisms underlying retinal diseases but also holds potential for developing targeted therapies. Elucidating the role of ELOVL4 in lipid metabolism could lead to novel strategies for treating genetic disorders associated with its dysfunction, thus improving outcomes for affected individuals. The study of ELOVL4 also connects to broader fields, such as metabolic regulation and neurobiology, given the integral role of fatty acids in membrane integrity, signaling, and energy homeostasis. Overall, understanding the recombinant ELOVL4 protein opens avenues for therapeutic innovation in retinopathies and contributes to the fundamental knowledge of lipid biology and cellular health.
