Analytical Data
-
Gene name
TIA1
- Application
-
Alternative Names
TIA1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31483
-
Expression Region
1-386 aa
-
AA Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIA1 (T-cell intracellular antigen 1) is a crucial RNA-binding protein involved in the regulation of mRNA metabolism and cellular stress responses. Research into TIA1 has gained prominence due to its significant roles in various biological processes, including cell differentiation, apoptosis, and immune response. TIA1 functions by modulating the stability and translation of target mRNAs, particularly under stress conditions, making it an essential player in the cellular response to environmental changes. Dysregulation of TIA1 has been associated with several diseases, notably neurodegenerative disorders, autoimmune conditions, and cancers, where altered mRNA processing and expression patterns contribute to disease pathology. The study of TIA1 and its role in the formation of stress granules—a form of cytoplasmic RNA-protein complexes that store and regulate mRNAs during stress—further highlights its importance in maintaining cellular homeostasis. Given its multifaceted biological functions and implications in disease, TIA1 is an attractive target for therapeutic intervention and biomarker development, necessitating further investigation into its structural dynamics, interaction networks, and regulatory mechanisms to understand its full potential in health and disease.
