Cat: PA1000-8211

Recombinant Human AIF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AIF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AIF;G1;IBA1;Allograft inflammatory factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95831

  • Expression Region

    121-613aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMEEVPQDKAPSHVPFLLIGGGTAAFAAARS IRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGK ERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGS QITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISRE VKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLS NWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVG LEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGR RRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVD SSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPA VPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHE DLNEVAKLFNIHED

  • Molecular Weight

    67 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AIF (Apoptosis-Inducing Factor) is a mitochondrial protein that plays a pivotal role in mediating apoptosis and necrosis in response to cellular stress. Initially discovered for its involvement in programmed cell death, AIF has garnered significant attention due to its dual function in cell survival and death pathways. Research has shown that AIF can translocate from mitochondria to the nucleus during apoptosis, where it interacts with nuclear components to induce chromatin condensation and DNA fragmentation. Furthermore, AIF’s role extends beyond apoptosis, being implicated in various pathological conditions, including neurodegenerative diseases and cancer. The interest in AIF has propelled studies focused on its structural characteristics, post-translational modifications, and interactions with other proteins. Understanding the molecular mechanisms underlying AIF's actions not only sheds light on fundamental aspects of cellular regulation but also paves the way for potential therapeutic strategies aimed at modulating its activity in diseases characterized by dysregulated cell death. The recombination and manipulation of AIF have become a focal point in research, enabling scientists to explore its functions in detail and assess its potential as a biomarker or target for drug development. This growing body of work signifies the importance of AIF in cellular biology and its relevance in developing interventions for diseases associated with cell death dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US