Analytical Data
-
Gene name
TNKS1
- Application
-
Alternative Names
TNKS1；PARP5A；PARPL；TIN1；Poly [ADP-ribose] polymerase tankyrase-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95271
-
Expression Region
1001-1327aa
-
AA Sequence
ELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFH CVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRI QKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQML FCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQA YPEYLITYQIMKPEAPSQTATAAEQKT
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNKS1 (Tankyrase 1) is a member of the poly(ADP-ribose) polymerase (PARP) family, primarily known for its role in regulating cellular processes such as telomere maintenance, Wnt signaling, and DNA repair through ADP-ribosylation. Research on TNKS1 has gained momentum due to its implications in cancer biology, particularly as it is often overexpressed in various malignancies, contributing to tumor progression and resistance to therapies. The enzyme catalyzes the addition of poly(ADP-ribose) chains to target proteins, influencing their stability and interactions, which plays a significant role in cellular signaling pathways. The development of TNKS1 inhibitors has emerged as a promising therapeutic strategy, targeting its enzymatic activity to disrupt pathological cellular processes. Reconstructing functional TNKS1 protein is essential for elucidating its biochemical properties and understanding its substrate interactions. Recent studies have focused on producing and characterizing recombinant TNKS1 proteins to analyze their structure and function, providing insights into the mechanisms of action and identifying novel substrates and regulators. These findings not only enhance our understanding of TNKS1's role in cellular functions but also pave the way for potential therapeutic interventions, underscoring the importance of TNKS1 research in the context of cancer treatment and cell biology.
