Analytical Data
-
Gene name
EIF4E2
- Application
-
Alternative Names
eIF-4E type 2;eIF4E type 2;Eukaryotic translation initiation factor 4E homologous protein;Eukaryotic translation initiation factor 4E-like 3;eIF4E-like protein 4E-LP;mRNA cap-binding protein 4EHP;h4EHP;mRNA cap-binding protein type 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60573
-
Expression Region
1-245aa
-
AA Sequence
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Eukaryotic translation initiation factor 4E2 (EIF4E2) is a key player in the regulation of protein synthesis and has garnered attention for its role in various cellular processes, including cell proliferation and apoptosis. Unlike its homolog EIF4E1, EIF4E2 exhibits distinct binding properties and functional mechanisms that suggest potential involvement in specific pathways and diseases. Recent studies indicate that EIF4E2 may be implicated in the regulation of viral mRNA translation, making it a potential target for antiviral therapies. Additionally, its differential expression in cancer cells indicates a role in tumorigenesis, prompting researchers to investigate its potential as a biomarker for cancer diagnosis and prognosis. The understanding of EIF4E2's interaction with various ligands, including mRNA and other initiation factors, is crucial for elucidating its functional significance. Consequently, the recombinant production of EIF4E2 is essential for in-depth mechanistic studies and the exploration of its role in therapeutic contexts. By characterizing EIF4E2 through purification and functional assays, researchers aim to uncover its precise biological functions, interactions, and potential implications in health and disease. Given the rising interest in translational control as a therapeutic target, elucidating the properties of EIF4E2 could provide valuable insights into novel treatment strategies for various disorders, particularly in oncology and virology.
