Cat: PA1000-8197

Recombinant Human TNKS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNKS2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNKS2;PARP5B;TANK2;TNKL;Poly [ADP-ribose] polymerase tankyrase-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H2K2

  • Expression Region

    667-1166aa

  • AA Sequence

    PDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPL HNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLA HGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVR SPGATADALSSGPSSPSSLSAASSLDNLSGSFSELSSVVSSSGTEGASSL EKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIG INAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQ SVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEV SEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSS KSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMA HSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG

  • Molecular Weight

    81 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The TNKS2 (Tankyrase 2) protein is a member of the tankyrase family, which plays a crucial role in various cellular processes, including telomere maintenance, cell proliferation, and DNA damage response. Initially identified for its poly(ADP-ribose) polymerase activity, TNKS2 interacts with multiple substrates involved in signal transduction and cellular regulation, making it a vital player in the Wnt signaling pathway. Dysregulation of TNKS2 has been implicated in various cancers, particularly as it influences the degradation of Axin and promotes β-catenin stabilization, a key factor in tumorigenesis. Given its significant function in cancer progression, TNKS2 has emerged as a promising therapeutic target, prompting researchers to explore its structure and enzymatic activities. Understanding the molecular mechanisms and interactions of TNKS2 could pave the way for the development of novel inhibitors that may effectively hinder cancer cell proliferation and survival, ultimately contributing to more effective cancer treatment strategies. Current studies are focusing on the biochemical characterization and the potential application of TNKS2 inhibitors in clinical settings, hoping to exploit its role in cancer signaling pathways for therapeutic benefit.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US