Analytical Data
-
Gene name
PTTG1IP
- Application
-
Alternative Names
PTTG1IP；C21orf1；C21orf3；Pituitary tumor-transforming gene 1 Protein-interacting Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53801
-
Expression Region
1-180aa
-
AA Sequence
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
-
Molecular Weight
20.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTTG1IP (PTTG1-interacting protein) is a notable protein that plays a crucial role in cell cycle regulation and tumorigenesis. Initially identified as a binding partner of the pituitary tumor-transforming gene 1 (PTTG1), PTTG1IP has been implicated in various cellular processes, including cell proliferation, apoptosis, and chromosomal stability. Research has shown that alterations in the expression levels of PTTG1IP can influence cancer progression, particularly in tumors of the breast, thyroid, and other tissues. Given its potential as a biomarker for cancer diagnosis and prognosis, as well as a therapeutic target, the recombinant expression of PTTG1IP has become a focus of scientific inquiry. Understanding its structure and function through recombinant protein techniques can provide insight into its role in oncogenesis and pave the way for the development of novel cancer treatment strategies. Additionally, the study of PTTG1IP may reveal new pathways that are essential for maintaining cellular homeostasis and could identify critical interactions that could be targeted in various malignancies. Therefore, the investigation of PTTG1IP as a recombinant protein offers promising avenues for enhancing our understanding of tumor biology and improving clinical outcomes for cancer patients.
