Analytical Data
-
Gene name
ZDHHC15
- Application
-
Alternative Names
ZDHHC15; UNQ1969/PRO4501; Palmitoyltransferase ZDHHC15; Acyltransferase ZDHHC15; Zinc finger DHHC domain-containing Protein 15; DHHC-15
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MV8
-
Expression Region
1-337 aa
-
AA Sequence
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
-
Molecular Weight
65.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC15, a member of the zinc finger DHHC-type palmitoyltransferase family, has garnered attention in recent years due to its critical role in the post-translational modification of proteins through palmitoylation, a process that significantly influences protein localization, stability, and function. Research has highlighted ZDHHC15's involvement in various cellular processes, including signal transduction and membrane trafficking, as it facilitates the addition of palmitate to cysteine residues of target proteins. Dysregulation of ZDHHC15 has been linked to several diseases, including cancer and neurological disorders, underscoring its potential as a therapeutic target. Additionally, the protein's unique features and mechanisms of action make it a subject of interest in biochemistry and molecular biology studies. Investigations into the structural and functional characteristics of ZDHHC15, especially through recombinant protein expression and purification techniques, are crucial for understanding its biochemical pathways and interactions with other cellular components. Improved knowledge of ZDHHC15's role in palmitoylation is expected to contribute to the development of targeted therapies that can modulate this modification in a disease context, providing insights into novel treatment strategies for conditions associated with aberrant protein palmitoylation.
